PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr000023.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NF-YB
Protein Properties Length: 173aa    MW: 19040.3 Da    PI: 9.0608
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr000023.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB149.28.4e-471811797
        NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97
                 mkk lPan+k+skdaketvqecvsefisf+t+easdkcqrekrkting+dllwa++tlGfe+yveplkvyl+k+re+egek
  Pbr000023.1  1 MKKGLPANGKVSKDAKETVQECVSEFISFITGEASDKCQREKRKTINGEDLLWAMTTLGFEEYVEPLKVYLHKFREMEGEK 81
                 9******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008088.7E-21155IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471131.53E-32188IPR009072Histone-fold
Gene3DG3DSA:1.10.20.101.0E-421100IPR009072Histone-fold
PRINTSPR006151.1E-211937No hitNo description
PROSITE patternPS0068502238IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.1E-213856No hitNo description
PRINTSPR006151.1E-215775No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MKKGLPANGK VSKDAKETVQ ECVSEFISFI TGEASDKCQR EKRKTINGED LLWAMTTLGF  60
EEYVEPLKVY LHKFREMEGE KMTGSTNTSA GTGTGMSAGH GRHADRYHRD HEREQLYVHG  120
HGAARDSING MYGVMSTQST TMMTMGHQQN HHRGGHLYGS GGKPSTGHGR PR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B6e-391761994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A6e-391761994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311581e-50KT031158.1 Glycine max clone HN_CCL_197 CCAAT transcription factor (Glyma15g12570.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009352424.11e-126PREDICTED: nuclear transcription factor Y subunit B-3-like
SwissprotO233102e-51NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLD7UAG51e-53D7UAG5_VITVI; Putative uncharacterized protein
TrEMBLM0S7Q81e-53M0S7Q8_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P13670_0014e-53(Musa acuminata)
STRINGVIT_19s0015g00440.t014e-53(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3790022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.11e-51nuclear factor Y, subunit B3